General Information

  • ID:  hor002802
  • Uniprot ID:  P20481
  • Protein name:  Buccalin gene-predicted acidic peptide A
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Cholinergic motor neuron B15 innervating buccal muscles in Aplysia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DSGEASGDLEE
  • Length:  11(339-349)
  • Propeptide:  MAHHRGHRHILLYVSLALSLGLALAEDATDPSDDTGSFDDVEAVSEEADLDPYSMSQELNKRPNVDPYSYLPSVGKRAFDHYGFTGGLGKRKIDHFGFVGGLGKRQIDPLGFSGGIGKRYDSFAYSAGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSLAFSGGLGKRGMDSFTFAPGLGKRGMDSLAFAGGLGKRMDGFAFAPGLG
  • Signal peptide:  MAHHRGHRHILLYVSLALSLGLALA
  • Modification:  T11 Glutamic acid 1-amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acting presynaptically on nerve terminals to inhibit acetylcholine release
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20481-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002802_AF2.pdbhor002802_ESM.pdb

Physical Information

Mass: 128659 Formula: C42H65N11O24
Absent amino acids: CFHIKMNPQRTVWY Common amino acids: E
pI: 3.23 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -130 Boman Index: -3606
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 44.55
Instability Index: 4938.18 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8101868
  • Title:  The Buccalin-Related Neuropeptides: Isolation and Characterization of an Aplysia cDNA Clone Encoding a Family of Peptide Cotransmitters